Iright
BRAND / VENDOR: Proteintech

Proteintech, 85766-4-RR, TAP1 Recombinant monoclonal antibody

CATALOG NUMBER: 85766-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TAP1 (85766-4-RR) by Proteintech is a Recombinant antibody targeting TAP1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 85766-4-RR targets TAP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HCT 116 cells, THP-1 cells, HepG2 cells, mouse spleen tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information TAP1, also known as ABCB2, PSF1 or RING4, is a member of the ATP-binding cassette (ABC) family of transmembrane transporters and is an essential component of the major histocompatability complex (MHC) class I antigen-presenting pathway. TAP is involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. It also acts as a molecular scaffold for the final stage of MHC class I folding. Defects in TAP1 are a cause of bare lymphocyte syndrome type 1 (BLS1). Western blot analysis using this antibody detected a major band around 70-80 kDa in HeLa cells. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1619 Product name: Recombinant human TAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 509-808 aa of BC014081 Sequence: LYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE Predict reactive species Full Name: transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) Calculated Molecular Weight: 81 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC014081 Gene Symbol: TAP1 Gene ID (NCBI): 6890 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q03518 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924