Iright
BRAND / VENDOR: Proteintech

Proteintech, 85769-4-RR, AKT3 Recombinant monoclonal antibody

CATALOG NUMBER: 85769-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The AKT3 (85769-4-RR) by Proteintech is a Recombinant antibody targeting AKT3 in WB, ELISA applications with reactivity to human, mouse, rat samples 85769-4-RR targets AKT3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information AKT3, also named as PKBG, is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. AKT3 is a key modulator of several tumors like melanoma, glioma and ovarian cancer. Active AKT3 increases progressively during melanoma tumor progression with highest levels present in advanced-stage metastatic melanomas. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16298 Product name: Recombinant human AKT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 95-155 aa of BC121154 Sequence: REEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLG Predict reactive species Full Name: v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma) Calculated Molecular Weight: 465 aa, 54 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC121154 Gene Symbol: AKT3 Gene ID (NCBI): 10000 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y243 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924