Iright
BRAND / VENDOR: Proteintech

Proteintech, 85789-3-RR, DDX18 Recombinant monoclonal antibody

CATALOG NUMBER: 85789-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The DDX18 (85789-3-RR) by Proteintech is a Recombinant antibody targeting DDX18 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 85789-3-RR targets DDX18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, K-562 cells, Jurkat cells, MCF-7 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information DDX18 (DEAD-box helicase 18) is a protein belonging to the DEAD-box deconjugating enzyme family that is widely involved in RNA metabolism. It plays a key role in the assembly of the ribosomal small subunit (SSU) and ensures efficient intracellular protein synthesis. DDX18 unwinds RNA double strands through its deconjugating enzyme activity, which is essential for the proper processing and functional execution of RNA molecules. In addition, DDX18 is a multifunctional RNA deconjugating enzyme involved in a variety of signaling pathways, playing a key role not only in ribosome assembly and RNA metabolism, but also in the regulation of a variety of biological processes such as cell cycle, genome stability and stem cell pluripotency. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27457 Product name: Recombinant human DDX18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-165 aa of BC001238 Sequence: KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC001238 Gene Symbol: DDX18 Gene ID (NCBI): 8886 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NVP1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924