Iright
BRAND / VENDOR: Proteintech

Proteintech, 85796-5-RR, SPR Recombinant monoclonal antibody

CATALOG NUMBER: 85796-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SPR (85796-5-RR) by Proteintech is a Recombinant antibody targeting SPR in WB, IF/ICC, ELISA applications with reactivity to human samples 85796-5-RR targets SPR in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HepG2 cells, HeLa cells, MCF-7 cells, A-549 cells, human skeletal muscle tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10395 Product name: Recombinant human SPR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC017310 Sequence: MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK Predict reactive species Full Name: sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) Calculated Molecular Weight: 261 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC017310 Gene Symbol: SPR Gene ID (NCBI): 6697 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35270 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924