Iright
BRAND / VENDOR: Proteintech

Proteintech, 85813-5-RR, CD302 Recombinant monoclonal antibody

CATALOG NUMBER: 85813-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CD302 (85813-5-RR) by Proteintech is a Recombinant antibody targeting CD302 in WB, IHC, ELISA applications with reactivity to mouse, rat samples 85813-5-RR targets CD302 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue, mouse liver tissue Positive IHC detected in: mouse liver tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis. In mice and humans, CD302 is primarily expressed in the liver, lungs, lymph nodes (LNs), spleen, and bone marrow. In CD302 gene knockout (CD302KO) mice, the migration frequency and number of myeloid dendritic cells (mDC) in CD302KO lymph nodes were reduced compared to the wild type, confirming the functional role of CD302 in mDC migration. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2660 Product name: Recombinant Mouse CD302 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-156 aa of NM_025422.4 Sequence: DCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHGADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAANNH Predict reactive species Full Name: CD302 antigen Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: NM_025422.4 Gene Symbol: Cd302 Gene ID (NCBI): 66205 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9DCG2-2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924