Iright
BRAND / VENDOR: Proteintech

Proteintech, 85821-1-RR, TNC/Tenascin-C Recombinant monoclonal antibody

CATALOG NUMBER: 85821-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TNC/Tenascin-C (85821-1-RR) by Proteintech is a Recombinant antibody targeting TNC/Tenascin-C in WB, ELISA applications with reactivity to mouse samples 85821-1-RR targets TNC/Tenascin-C in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse colon tissue, mouse thymus tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Tenascin-C (TNC) is a large hexameric extracellular matrix glycoprotein of the tenascin family (PMID: 21818551). It is a multimodular protein containing multiple epidermal growth factor (EGF)-like repeats and fibronectin type III (FN III) domains (PMID: 1719530). Tenascin-C is highly expressed during embryonic development, particularly in the developing central nervous system, around motile cells and at epithelial-mesenchymal interaction sites (PMID: 25738825). In adult tissues, the expression and the distribution of TNC are typically limited under normal physiological conditions. It is upregulated during injury, inflammation, regeneration, and cancer (PMID: 7694605; 25120494). Tenascin-C is a diverse protein that can produce different functions including regulating cell adhesion, migration and proliferation. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2849 Product name: Recombinant Mouse Tnc protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1884-2099 aa of N/A Sequence: GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN Predict reactive species Full Name: tenascin C Calculated Molecular Weight: 232 kDa Observed Molecular Weight: 210-230 kDa GenBank Accession Number: N/A Gene Symbol: Tnc Gene ID (NCBI): 21923 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q80YX1-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924