Proteintech, 85830-1-RR, C6orf15 Recombinant monoclonal antibody

Size: 20ul / 100ul The C6orf15 (85830-1-RR) by Proteintech is a Recombinant antibody targeting C6orf15 in WB, ELISA applications with reactivity to human samples 85830-1-RR targets C6orf15 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HaCaT cells, Caco-2 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information C6orf15, also named as Protein STG, is a 325 amino acid protein, which as a secreted protein is expressed in skin and tonsils. The calculated molecular weight of C6orf15 is 34 kDa, but we detected a 50-55 kDa protein by western blot. C6orf15 may contains some modified residues. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20276 Product name: Recombinant human C6orf15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-325 aa of BC153157 Sequence: RSIGVVEEKVSQNLGTNLPQLGQPSSTGPSNSEHPQPALDPRSNDLARVPLKLSVPASDGFPPAGGSAVQRWPPSWGLPAMDSWPPEDPWQMMAAAAEDRLGEALPEELSYLSSAAALAPGSGPLPGESSPDATGLSPKASLLHQDSESRRLPRSNSLGAGGKILSQRPPWSLIHRVLPDHPWGTLNPSVSWGGGGPGTGWGTRPMPHPEGIWGINNQPPGTSWGNINRYPGGSWGNINRYPGGSWGNINRYPGGSWGNIHLYPGINNPFPPGVLRPPGSSWNIPAGFPNPPSPRLQWG Predict reactive species Full Name: chromosome 6 open reading frame 15 Calculated Molecular Weight: 325 aa, 34 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC153157 Gene Symbol: C6orf15 Gene ID (NCBI): 29113 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6UXA7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.