Proteintech, 85849-4-RR, DCUN1D1 Recombinant monoclonal antibody

Size: 20ul / 100ul The DCUN1D1 (85849-4-RR) by Proteintech is a Recombinant antibody targeting DCUN1D1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 85849-4-RR targets DCUN1D1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HT-29 cells, HeLa cells, HepG2 cells, Jurkat cells, mouse brain tissue Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information It has been found that DCUN1D1, also known as squamous cell carcinoma-related oncogene, expression may play a role in development of brain metastasis in patients with Non-small cell lung carcinoma (NSCLC). DCUN1D1-positive tumor cells may have the ability to disrupt the blood-brain-barrier and colonize the brain. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1440 Product name: Recombinant human DCUN1D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-259 aa of BC009478 Sequence: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV Predict reactive species Full Name: DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC009478 Gene Symbol: DCUN1D1 Gene ID (NCBI): 54165 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96GG9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.