Iright
BRAND / VENDOR: Proteintech

Proteintech, 85852-4-RR, POLG2 Recombinant monoclonal antibody

CATALOG NUMBER: 85852-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The POLG2 (85852-4-RR) by Proteintech is a Recombinant antibody targeting POLG2 in WB, ELISA applications with reactivity to human, mouse, rat samples 85852-4-RR targets POLG2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, H9C2 cells, mouse colon tissue, rat colon tissue, COLO 320 cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information by POLG) and an accessory subunit (encoded by POLG2). POLG2(DNA polymerase subunit gamma-2, mitochondrial) can stimulate the polymerase and exonuclease activities (PMID: 37085601). Defects in POLG2 are the cause of progressive external ophthalmoplegia with mitochondrial DNA deletions autosomal dominant type 4 (PEOA4) (PMID: 16685652).Western blot result suggested that the POLG2 expressed in cell lines with a single band of 52-55kd. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1424 Product name: Recombinant human POLG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 136-485 aa of BC009194 Sequence: GPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPAYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV Predict reactive species Full Name: polymerase (DNA directed), gamma 2, accessory subunit Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 52-55 kDa GenBank Accession Number: BC009194 Gene Symbol: POLG2 Gene ID (NCBI): 11232 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UHN1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924