Iright
BRAND / VENDOR: Proteintech

Proteintech, 85884-5-RR, RBBP6 Recombinant monoclonal antibody

CATALOG NUMBER: 85884-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RBBP6 (85884-5-RR) by Proteintech is a Recombinant antibody targeting RBBP6 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 85884-5-RR targets RBBP6 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: EC109 cells, NIH/3T3 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information RBBP6 (retinoblastoma binding protein 6) is a multifunctional protein that interacts with both p53 and pRb and has been implicated in mRNA processing. It has also been identified as a putative E3 ubiquitin ligase due to the presence of a RING finger domain [PMID:18851979]. RBBP6 contains an N-terminal ubiquitin-like domain and a cysteine-rich RING finger-like domain, through which it promotes the ubiquitination of p53 by Hdm2 in an E4-like manner [PMID:17470788]. It is implicated in a diverse set of cellular functions, including mRNA metabolism, regulation of the cell cycle, tumorigenesis, and development [PMID:12938151,17470788]. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2484 Product name: Recombinant human RBBP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC029352 Sequence: MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL Predict reactive species Full Name: retinoblastoma binding protein 6 Calculated Molecular Weight: 1792 aa, 200 kDa Observed Molecular Weight: 250 kDa GenBank Accession Number: BC029352 Gene Symbol: RBBP6 Gene ID (NCBI): 5930 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q7Z6E9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924