Iright
BRAND / VENDOR: Proteintech

Proteintech, 85895-3-RR, Cyclin B1 Recombinant monoclonal antibody

CATALOG NUMBER: 85895-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Cyclin B1 (85895-3-RR) by Proteintech is a Recombinant antibody targeting Cyclin B1 in WB, ELISA applications with reactivity to human samples 85895-3-RR targets Cyclin B1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:3000-1:5000 Background Information Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29426 Product name: Recombinant human CCNB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC006510 Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE Predict reactive species Full Name: cyclin B1 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC006510 Gene Symbol: Cyclin B1 Gene ID (NCBI): 891 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P14635 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924