Iright
BRAND / VENDOR: Proteintech

Proteintech, 85897-5-RR, TRMT1 Recombinant monoclonal antibody

CATALOG NUMBER: 85897-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TRMT1 (85897-5-RR) by Proteintech is a Recombinant antibody targeting TRMT1 in WB, IF/ICC, ELISA applications with reactivity to human, rat samples 85897-5-RR targets TRMT1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, HepG2 cells, K-562 cells, HCT 116 cells, rat testis tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information TRMT1 is an RNA methyltransferase responsible for the formation of N2,N2-dimethylguanosine (m2,2G) at position 26 in both cytosolic and mitochondrial tRNAs.TRMT1-catalyzed tRNA modifications are important for maintenance of global protein translation levels including proteins involved in cellular growth, development, and stress response. Human neural stem cells with TRMT1 knockdowns were found to have hypersensitivity to redox stress, implicating TRMT1 and the m2,2G26 modification in the regulation of redox homeostasis. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6837 Product name: Recombinant human TRMT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 371-659 aa of BC002492 Sequence: KFSAACGPPVTPECEHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPGRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTPSLLQLRSALLHADFRVSLSHACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPSSRQRGLKRFQANPEANWGPRPRARPGGKAADEAMEERRRLLQNKRKEPPEDVAQRAARLKTFPCKRFKEGTCQRGDQCCYSHSPPTPRVSADAAPDCPETSNQTPPGPGAAAGPGID Predict reactive species Full Name: TRM1 tRNA methyltransferase 1 homolog (S. cerevisiae) Calculated Molecular Weight: 81 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC002492 Gene Symbol: TRMT1 Gene ID (NCBI): 55621 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NXH9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924