Proteintech, 85902-1-RR, TNFRSF13B/CD267 Recombinant monoclonal antibody

Size: 20ul / 100ul The TNFRSF13B/CD267 (85902-1-RR) by Proteintech is a Recombinant antibody targeting TNFRSF13B/CD267 in WB, IHC, IF/ICC, ELISA applications with reactivity to mouse samples 85902-1-RR targets TNFRSF13B/CD267 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: A20 cells Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A20 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Tumor necrosis factor receptor superfamily member 13B (TNFRSF13B), also known as CD267 or TACI, is a transmembrane protein of the TNF receptor superfamily found predominantly on B cells (PMID: 10920230). TACI is also expressed on activated T cells, myeloma cells, and expressed by monocytes intracellularly at a low level (PMID: 11429548; 16825497). TNFRSF13B is a receptor for TNFSF13/APRIL/CD256 and TNFSF13B/BAFF/CD257 and mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-κB and AP-1 (PMID: 10956646; 10973284; 9311921). It is involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1814 Product name: Recombinant Mouse TNFRSF13B/CD267 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 5-128 aa of NM_021349.1 Sequence: FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYC Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 13b Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 30-32 kDa GenBank Accession Number: NM_021349.1 Gene Symbol: Tnfrsf13b Gene ID (NCBI): 57916 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9ET35 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.