Proteintech, 85916-1-RR, ATP1B1 Recombinant monoclonal antibody

Size: 20ul / 100ul The ATP1B1 (85916-1-RR) by Proteintech is a Recombinant antibody targeting ATP1B1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85916-1-RR targets ATP1B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, fetal human brain tissue, mouse heart tissue, rat heart tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information ATP1B1 is one of beta subunits of the Na+/K+ ATPase and responsible for formation and structural integrity of the Na+/K+ ATPase. The Na+/K+ ATPase is a plasma membrane pump consisting of alpha, beta, and gamma subunits. At least four of Na+/K+-ATPase beta subunits (β1, β2, β3, β4) have been identified in mammalian cells; the β1-subunit (ATP1B1) is the most ubiquitous. The Na+/K+ ATPase β subunits have multiple N-glycosylation sites. The predicted MW of ATP1B1 is 35 kDa, while it migrates around 40-52 kDa due to the variable glycosylation. (PMID: 10896885, 17714085) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3007 Product name: Recombinant Mouse Atp1b1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 63-304 aa of NM_009721.6 Sequence: ELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS Predict reactive species Full Name: ATPase, Na+/K+ transporting, beta 1 polypeptide Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: NM_009721.6 Gene Symbol: Atp1b1 Gene ID (NCBI): 11931 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P14094 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.