Iright
BRAND / VENDOR: Proteintech

Proteintech, 85943-1-RR, EVI2B Recombinant monoclonal antibody

CATALOG NUMBER: 85943-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The EVI2B (85943-1-RR) by Proteintech is a Recombinant antibody targeting EVI2B in WB, IF/ICC, ELISA applications with reactivity to human samples 85943-1-RR targets EVI2B in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, Ramos cells, THP-1 cells, HL-60 cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Ecotropic viral integration site 2B protein (EVI2B) is a type I transmembrane protein embedded within intron 27b of the neurofibromatosis type 1 (NF1) gene. It is transcribed in the opposite direction to the NF1 gene (PMID: 37584733). EVI2B is a downstream target of CCAAT/enhancer binding protein alpha (C/EBPα), which is crucial for myeloid differentiation and the function of hematopoietic progenitors (PMID: 36830696). This protein is highly expressed in mature granulocytes and is involved in the regulation of immune cell maturation (PMID: 28186500). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3709 Product name: Recombinant Human EVI2B protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-202 aa of BC005926 Sequence: KTETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQSISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAVFTSARQLPSARTSTTQPPKSFVYTFTQQSSSVQIPSRKQITVHNPSTQPTSTVKNSPRSTPGFILDTTSNKQTPQKNNYNS Predict reactive species Full Name: ecotropic viral integration site 2B Calculated Molecular Weight: 448 aa, 49 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC005926 Gene Symbol: EVI2B Gene ID (NCBI): 2124 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P34910 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924