Iright
BRAND / VENDOR: Proteintech

Proteintech, 85961-1-RR, IL-17RB Recombinant monoclonal antibody

CATALOG NUMBER: 85961-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IL-17RB (85961-1-RR) by Proteintech is a Recombinant antibody targeting IL-17RB in WB, ELISA applications with reactivity to mouse, rat samples 85961-1-RR targets IL-17RB in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, Transfected HEK-293T cells, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information IL-17RB is a transmembrane protein that belongs to the IL-17 receptor family. IL-17RB has a SEFIR cytoplasmic domain implicated in homotypic dimerization and recruitment of signaling proteins (shared with IL-17RA) and a TRAF6-binding domain (not found in IL-17RA). IL-17RB is expressed in various endocrine tissues and epithelial cells in different organs such as kidney, liver, and mucosal tissues. The IL-17B/IL-17RB pathway is considered as a signaling cascade that promotes cancer cell survival, proliferation and migration. The pro-tumor functions associated with the IL 17B/IL-17RB pathway are diverse and complex because they involve mechanisms that act directly on tumor cells, and also indirect mechanisms that lead to tumor microenvironment remodeling. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2798 Product name: recombinant mouse Il17rb protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 18-286 aa of NM_019583.3 Sequence: REPTIQCGSETGPSPEWMVQHTLTPGDLRDLQVELVKTSVAAEEFSILMNISWILRADASIRLLKATKICVSGKNNMNSYSCVRCNYTEAFQSQTRPSGGKWTFSYVGFPVELSTLYLISAHNIPNANMNEDSPSLSVNFTSPGCLNHVMKYKKQCTEAGSLWDPDITACKKNEKMVEVNFTTNPLGNRYTILIQRDTTLGFSRVLENKLMRTSVAIPVTEESEGAVVQLTPYLHTCGNDCIRREGTVVLCSETSAPIPPDDNRRMLGG Predict reactive species Full Name: interleukin 17 receptor B Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: NM_019583.3 Gene Symbol: Il17rb Gene ID (NCBI): 50905 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9JIP3-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924