Iright
BRAND / VENDOR: Proteintech

Proteintech, 85980-2-RR, ALDH1L1 Recombinant monoclonal antibody

CATALOG NUMBER: 85980-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ALDH1L1 (85980-2-RR) by Proteintech is a Recombinant antibody targeting ALDH1L1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85980-2-RR targets ALDH1L1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: rat liver tissue, human pancreas cancer tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Aldehyde dehydrogenase 1 family member L1 (ALDH1L1), belongs to the aldehyde dehydrogenase family of proteins and is responsible for formate oxidation in vivo. Loss of ALDH1L1 is associated with decreased apoptosis, increased cell motility, and cancer progression. ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, nicotinamide adenine dinucleotide phosphate (NADP+), and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 has some isoforms with MW of 99, 88 and 55 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11285 Product name: Recombinant human ALDH1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 157-505 aa of BC027241 Sequence: DDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKISARDRGRLMYRAPPSPSTRPDPTAT Predict reactive species Full Name: aldehyde dehydrogenase 1 family, member L1 Calculated Molecular Weight: 99 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC027241 Gene Symbol: ALDH1L1 Gene ID (NCBI): 10840 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75891 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924