Iright
BRAND / VENDOR: Proteintech

Proteintech, 85984-1-RR, LILRA5/CD85f Recombinant monoclonal antibody

CATALOG NUMBER: 85984-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The LILRA5/CD85f (85984-1-RR) by Proteintech is a Recombinant antibody targeting LILRA5/CD85f in WB, ELISA applications with reactivity to human samples 85984-1-RR targets LILRA5/CD85f in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, Raji cells, U-937 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information LILRA5, also named as CD85f, ILT11, LILRB7 or LIR9, is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is a group of immune inhibitory and stimulatory receptors (PMID: 15304001). There are two membrane-bound and two soluble forms of LILRA5. The transmembrane LILRA5 contains a short cytoplasmic domain and a charged arginine residue within the transmembrane region (PMID: 19009525). It is mostly expressed in myeloid cells, including monocytes and neutrophils (PMID: 12393390). LILRA5 may play a role in triggering innate immune responses. It does not function in class I MHC antigens recognition (PMID: 16675463). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2737 Product name: Recombinant Human LILRA5/CD85f protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 42-268 aa of NM_021250.4 Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR Predict reactive species Full Name: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: NM_021250.4 Gene Symbol: LILRA5 Gene ID (NCBI): 353514 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: A6NI73-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924