Iright
BRAND / VENDOR: Proteintech

Proteintech, 85985-1-RR, Surfactant protein D Recombinant monoclonal antibody

CATALOG NUMBER: 85985-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Surfactant protein D (85985-1-RR) by Proteintech is a Recombinant antibody targeting Surfactant protein D in WB, IHC, IP, ELISA applications with reactivity to mouse, rat samples 85985-1-RR targets Surfactant protein D in WB, IHC, IP, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, rat lung tissue Positive IP detected in: mouse lung tissue Positive IHC detected in: mouse lung tissue, rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information Surfactant protein D (SP-D) is a pattern recognition molecule of the collectin family of C-type lectins, which consist of four structural domains: a cysteine-rich N-terminal domain, a collagen-like region, an alpha-helical coiled-coil neck domain and a C-terminal lectin or carbohydrate-recognition domain (PMID: 16213021; 15030473). SP-D is primarily expressed and secreted by type II alveolar cells (PMID: 16684127). It plays a central role in the pulmonary host defence and the modulation of allergic responses. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2924 Product name: Recombinant Mouse Surfactant protein D protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-374 aa of NM_009160.2 Sequence: AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEF Predict reactive species Full Name: surfactant associated protein D Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_009160.2 Gene Symbol: Sftpd Gene ID (NCBI): 20390 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P50404 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924