Iright
BRAND / VENDOR: Proteintech

Proteintech, 85987-2-RR, YWHAH Recombinant monoclonal antibody

CATALOG NUMBER: 85987-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The YWHAH (85987-2-RR) by Proteintech is a Recombinant antibody targeting YWHAH in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85987-2-RR targets YWHAH in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Raji cells, A431 cells, NIH/3T3 cells, fetal human brain tissue, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information YWHAH (also known as 14-3-3 eta) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody was raised against the full-length YWHAH. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7435 Product name: Recombinant human YWHAH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC003047 Sequence: MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN Predict reactive species Full Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC003047 Gene Symbol: YWHAH Gene ID (NCBI): 7533 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q04917 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924