Iright
BRAND / VENDOR: Proteintech

Proteintech, 85996-1-RR, PDE3B Recombinant monoclonal antibody

CATALOG NUMBER: 85996-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PDE3B (85996-1-RR) by Proteintech is a Recombinant antibody targeting PDE3B in WB, IHC, ELISA applications with reactivity to human, mouse samples 85996-1-RR targets PDE3B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse adipose tissue, Jurkat cells Positive IHC detected in: mouse adipose tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information PDE3B is a cyclic nucleotide phosphodiesterase with dual specificity for cAMP and cGMP. It plays crucial roles in regulating physiological processes such as angiogenesis and cardiac contractility. PDE3B can be activated by insulin and is involved in the antilipolytic actions of insulin. Additionally, PDE3B forms macromolecular complexes that are important for its activation and interaction with other proteins (PMID: 22001403, PMID: 26031333). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19190 Product name: Recombinant human PDE3B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 321-670 aa of BC136565 Sequence: CISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEARNMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLDLILVEEYDSL Predict reactive species Full Name: phosphodiesterase 3B, cGMP-inhibited Calculated Molecular Weight: 1112 aa, 124 kDa Observed Molecular Weight: 124 kDa GenBank Accession Number: BC136565 Gene Symbol: PDE3B Gene ID (NCBI): 5140 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13370 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924