Iright
BRAND / VENDOR: Proteintech

Proteintech, 86006-4-RR, ANGPTL4 Recombinant monoclonal antibody

CATALOG NUMBER: 86006-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ANGPTL4 (86006-4-RR) by Proteintech is a Recombinant antibody targeting ANGPTL4 in WB, ELISA applications with reactivity to mouse, rat samples 86006-4-RR targets ANGPTL4 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue, mouse liver tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ANGPTL4 was first identified in adipose tissue and later found to be widely expressed in several tissues including the liver, skeletal muscle, small intestine, placenta, heart, and kidney. ANGPTL4 expression was first identified to be regulated by peroxisome proliferator-activator receptors (PPARs), PPARα and PPARγ. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2770 Product name: Recombinant Mouse ANGPTL4 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 168-410 aa of NM_020581.2 Sequence: RLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS Predict reactive species Full Name: angiopoietin-like 4 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: NM_020581.2 Gene Symbol: Angptl4 Gene ID (NCBI): 57875 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Z1P8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924