Proteintech, 86046-2-RR, EYA2 Recombinant monoclonal antibody

Size: 20ul / 100ul The EYA2 (86046-2-RR) by Proteintech is a Recombinant antibody targeting EYA2 in WB, ELISA applications with reactivity to human samples 86046-2-RR targets EYA2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: IMR-32 cells, Y79 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information EYA2, also named EAB1, belongs to the HAD-like hydrolase superfamily and EYA family. It coactivates SIX1. The Six1-EYA2 interaction may inhibit breast cancer progression. EYA2 is required for Six1-activated TGF-beta signaling.(PMID:21706047) It may be involved in the development of the eye. This protein has 3 isoforms produced by alternative splicing with the molecular weight of 59 kDa, 57 kDa, and 50 kDa. This recombinant antibody can not detect the modified isform with the molecular weight of 70 kda, compared with 11314-1-AP. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29403 Product name: Recombinant human EYA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 241-583 aa of BC013882 Sequence: LSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL Predict reactive species Full Name: eyes absent homolog 2 (Drosophila) Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC013882 Gene Symbol: EYA2 Gene ID (NCBI): 2139 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00167 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.