Proteintech, 86075-1-RR, PCNP Recombinant monoclonal antibody

Size: 20ul / 100ul The PCNP (86075-1-RR) by Proteintech is a Recombinant antibody targeting PCNP in WB, IF/ICC, ELISA applications with reactivity to human samples 86075-1-RR targets PCNP in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, Jurkat cells, Raji cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30951 Product name: Recombinant human PCNP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC013916 Sequence: MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKI Predict reactive species Full Name: PEST proteolytic signal containing nuclear protein Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 24-28 kDa GenBank Accession Number: BC013916 Gene Symbol: PCNP Gene ID (NCBI): 57092 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8WW12 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.