Iright
BRAND / VENDOR: Proteintech

Proteintech, 86095-1-RR, TRMU Recombinant monoclonal antibody

CATALOG NUMBER: 86095-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TRMU (86095-1-RR) by Proteintech is a Recombinant antibody targeting TRMU in WB, ELISA applications with reactivity to human, mouse, rat samples 86095-1-RR targets TRMU in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, A549 cells, MCF-7 cells, U2OS cells, NIH/3T3 cells, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TRMU (tRNA m5C methyltransferase) is a mitochondrial protein involved in the modification of mitochondrial tRNA. Specifically, it catalyzes the formation of 5-methylcytidine at position 34 (m5C34) in the anticodon stem-loop of mitochondrial tRNAs, which is crucial for maintaining the stability and function of these tRNAs. TRMU is a nuclear-encoded protein located in the mitochondrial matrix. It plays a vital role in mitochondrial translation and oxidative phosphorylation.TRMU is associated with several genetic disorders. Mutations in the TRMU gene can cause mitochondrial diseases, such as infantile hepatic failure syndrome. (PMID:23625533) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21930 Product name: Recombinant human TRMU protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-267 aa of BC027991 Sequence: MKKSLSRSTLRSPKGFSEIGLKLEMVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL Predict reactive species Full Name: tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase Calculated Molecular Weight: 421 aa, 48 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC027991 Gene Symbol: TRNT1 Gene ID (NCBI): 55687 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75648 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924