Iright
BRAND / VENDOR: Proteintech

Proteintech, 86114-3-RR, VISTA Recombinant monoclonal antibody

CATALOG NUMBER: 86114-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The VISTA (86114-3-RR) by Proteintech is a Recombinant antibody targeting VISTA in WB, IHC, ELISA applications with reactivity to mouse samples 86114-3-RR targets VISTA in WB, IHC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: bEnd.3 cells, mouse spleen tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information VISTA, also known as PD-1H, Dies1, and Gi24, is encoded by the Vsir gene in mice. VISTA is a type I transmembrane protein that acts as an immune-regulatory checkpoint on hematopoietic cells and shares homology with both the B7 family ligand PD-L1 and the CD28 family receptor PD-1. In mice, VISTA is expressed predominantly in hematopoietic tissues, such as the spleen, thymus, lymph node, and bone marrow (BM). VISTA plays a key role in regulating immune system responses and maintaining homeostasis. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2809 Product name: Recombinant Mouse VISTA protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 33-191 aa of NM_001159572.1 Sequence: FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA Predict reactive species Full Name: RIKEN cDNA 4632428N05 gene Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 40-55 kDa GenBank Accession Number: NM_001159572.1 Gene Symbol: 4632428N05Rik Gene ID (NCBI): 74048 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9D659 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924