Proteintech, 86167-1-RR, NDP52 Recombinant monoclonal antibody

Size: 20ul / 100ul The NDP52 (86167-1-RR) by Proteintech is a Recombinant antibody targeting NDP52 in WB, IF/ICC, ELISA applications with reactivity to human samples 86167-1-RR targets NDP52 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, A549 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NDP52, also named as CALCOCO2, is an autophagy receptor. It plays a role in ruffle formation and actin cytoskeleton organization. Mouse/Rat NDP52 has some isoforms with MW 28-40 kDa and 67 kDa. Human NDP52 has some isoforms with MW 43-47 kDa and 52-55 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2866 Product name: Recombinant human CALCOCO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-283 aa of BC015893 Sequence: MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLE Predict reactive species Full Name: calcium binding and coiled-coil domain 2 Calculated Molecular Weight: 446 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC015893 Gene Symbol: NDP52 Gene ID (NCBI): 10241 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13137 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.