Iright
BRAND / VENDOR: Proteintech

Proteintech, 86169-2-RR, CSNK2A2 Recombinant monoclonal antibody

CATALOG NUMBER: 86169-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CSNK2A2 (86169-2-RR) by Proteintech is a Recombinant antibody targeting CSNK2A2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86169-2-RR targets CSNK2A2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, A-673 cells, Jurkat cells, NIH/3T3 cells, PC-12 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CSNK2A2(Casein kinase II subunit alpha') is also named as CK2A3, CK2A2, CSNK2A1, CK2 and belongs to the protein kinase superfamily. It can function as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage during mitosis. It also can protect against ionizing radiation-induced apoptosis partly by phosphorylating and activating SIRT1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0877 Product name: Recombinant human CSNK2A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-350 aa of BC008812 Sequence: KYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR Predict reactive species Full Name: casein kinase 2, alpha prime polypeptide Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC008812 Gene Symbol: CSNK2A2 Gene ID (NCBI): 1459 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P19784 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924