Iright
BRAND / VENDOR: Proteintech

Proteintech, 86178-1-RR, CA13 Recombinant monoclonal antibody

CATALOG NUMBER: 86178-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CA13 (86178-1-RR) by Proteintech is a Recombinant antibody targeting CA13 in WB, ELISA applications with reactivity to human, mouse, rat samples 86178-1-RR targets CA13 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse thymus tissue, NIH/3T3 cells, rat small intestine tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Carbonic anhydrases (CAs) are zinc-containing metalloenzymes that catalyze the reversible hydration of carbon dioxide. The mammalian α-CA gene family has been reported to include at least eleven enzymatically active isoforms with different structural and catalytic properties. Four of the active CA isozymes are cytosolic (CA I, II, III, and VII), four are membrane-associated(CA IV, IX, XII, and XIV), two are mitochondrial (CA VA and VB), and one is a secretory form (CA VI). CA13 is a cytosolic protein that may play a role in embryogenesis and perturbation of its function by genetic modification could potentially lead to developmental abnormalities(PMID:14600151). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10086 Product name: Recombinant human CA13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-262 aa of BC052602 Sequence: MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH Predict reactive species Full Name: carbonic anhydrase XIII Calculated Molecular Weight: 262 aa, 29 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC052602 Gene Symbol: CA13 Gene ID (NCBI): 377677 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N1Q1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924