Proteintech, 86180-5-RR, CCR7 Recombinant monoclonal antibody

Size: 20ul / 100ul The CCR7 (86180-5-RR) by Proteintech is a Recombinant antibody targeting CCR7 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86180-5-RR targets CCR7 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: T-47D cells, MCF-7 cells, K-562 cells, C6 cells Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information C-C chemokine receptor type 7 (CCR7) , which belongs to the G-protein coupled receptor 1 family, is also a receptor for the MIP-3-beta chemokine, and probablely acts as mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions. CCR7 is specially expressed in various lymphoid tissues and activated B- and T-lymphocytes, and can be strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2354 Product name: recombinant human CCR7 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 25-59 aa of BC035343 Sequence: QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAW Predict reactive species Full Name: chemokine (C-C motif) receptor 7 Calculated Molecular Weight: 378 aa, 43 kDa Observed Molecular Weight: 40-43 kDa GenBank Accession Number: BC035343 Gene Symbol: CCR7 Gene ID (NCBI): 1236 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P32248 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.