Iright
BRAND / VENDOR: Proteintech

Proteintech, 86184-1-RR, SOX13 Recombinant monoclonal antibody

CATALOG NUMBER: 86184-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SOX13 (86184-1-RR) by Proteintech is a Recombinant antibody targeting SOX13 in WB, IF/ICC, ELISA applications with reactivity to human samples 86184-1-RR targets SOX13 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells, SK-BR-3 cells, BGC-823 cells, SW480 cells Positive IF/ICC detected in: SK-BR-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information SRY-BOX 13(SOX13), identified a sequence homologous more than 60% to the SRY HMG box ,with a centrally located HMG box and an N-terminal leucine zipper motif with a neighboring glutamine stretch called a Q box. SOX13 binds to the consensus HMG-box motif. It's an IDDM-specific human autoantigen, and a gamma-delta-specific gene in the immune system. It can modulates Wnt/TCF activity. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13537 Product name: Recombinant human SOX13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC106038 Sequence: MSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDVKGTQESLAEKELQLLVMIHQLSTLRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRPGAMATHHPLQEPSQPLNLTAKPKA Predict reactive species Full Name: SRY (sex determining region Y)-box 13 Calculated Molecular Weight: 622 aa, 69 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC106038 Gene Symbol: SOX13 Gene ID (NCBI): 9580 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UN79 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924