Iright
BRAND / VENDOR: Proteintech

Proteintech, 86188-1-RR, MARVELD2 Recombinant monoclonal antibody

CATALOG NUMBER: 86188-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MARVELD2 (86188-1-RR) by Proteintech is a Recombinant antibody targeting MARVELD2 in WB, IF/ICC, ELISA applications with reactivity to human samples 86188-1-RR targets MARVELD2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information MARVELD2, also named as Tricellulin or TRIC, is a 558 amino acid protein, which contains one MARVEL domain. MARVELD2 localizes the cell membrane and plays a role in the formation of the epithelial barriers. MARVELD2, is a first integral membrane protein that is concentrated at the vertically oriented tight junction strands of tricellular contacts. MARVELD2 may be a component to maintain the integrity for peripheral nervous system myelin function and morphology. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4446 Product name: Recombinant human MARVELD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 365-558 aa of BC033689 Sequence: LWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMKPELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDVQGYS Predict reactive species Full Name: MARVEL domain containing 2 Calculated Molecular Weight: 558 aa, 64 kDa Observed Molecular Weight: 60-64 kDa GenBank Accession Number: BC033689 Gene Symbol: MARVELD2 Gene ID (NCBI): 153562 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N4S9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924