Iright
BRAND / VENDOR: Proteintech

Proteintech, 86194-3-RR, OLR1/LOX1 Recombinant monoclonal antibody

CATALOG NUMBER: 86194-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The OLR1/LOX1 (86194-3-RR) by Proteintech is a Recombinant antibody targeting OLR1/LOX1 in WB, ELISA applications with reactivity to human, mouse samples 86194-3-RR targets OLR1/LOX1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human placenta tissue, bEnd.3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information OLR1/LOX-1 acts as a receptor, in the form of a homodimer, that mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein (oxLDL) (PMID: 9052782, 15695803). ORL1 is predominantly expressed in endothelial cells and vascular-rich organs such as the placenta, lung, liver, and brain (PMID: 9828121). OLR1 is a protein containing 273 amino acids with a calculated molecular mass of 31 kDa but an apparent molecular mass of 50 kDa, which may result from the glycosylation of four potential N-linked glycosylation sites located at the C-terminal domain (PMID: 9052782). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2911 Product name: Recombinant Human OLR1/LOX1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 61-273 aa of NM_002543.3 Sequence: SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ Predict reactive species Full Name: oxidized low density lipoprotein (lectin-like) receptor 1 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: NM_002543.3 Gene Symbol: OLR1 Gene ID (NCBI): 4973 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P78380-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924