Iright
BRAND / VENDOR: Proteintech

Proteintech, 86202-1-RR, MCOLN3 Recombinant monoclonal antibody

CATALOG NUMBER: 86202-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MCOLN3 (86202-1-RR) by Proteintech is a Recombinant antibody targeting MCOLN3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 86202-1-RR targets MCOLN3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, HeLa cells, SH-SY5Y cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MCOLN3 (Mucolipin 3) is a member of the TRPML (Transient Receptor Potential Mucolipin) gene family and encodes a non-selective cation channel protein that is primarily localized on the membranes of endosomes and lysosomes. MCOLN3 promotes endosome acidification, regulates membrane transport and fusion, and is involved in the autophagy process. Additionally, MCOLN3 is involved in the regulation of intracellular calcium (Ca²⁺) and iron (Fe²⁺) ion homeostasis, maintains lysosomal membrane potential, promotes endosome-lysosome fusion and material transport (such as autophagy), and may also be involved in neuronal signaling and immune regulation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4962 Product name: Recombinant human MCOLN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 86-285 aa of BC060765 Sequence: MVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAYENKGTKQSAMAICQHLYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQKNTHYM Predict reactive species Full Name: mucolipin 3 Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC060765 Gene Symbol: MCOLN3 Gene ID (NCBI): 55283 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8TDD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924