Proteintech, 86213-1-RR, CD25/IL-2RA Recombinant monoclonal antibody

Size: 20ul / 100ul The CD25/IL-2RA (86213-1-RR) by Proteintech is a Recombinant antibody targeting CD25/IL-2RA in WB, ELISA applications with reactivity to mouse, rat samples 86213-1-RR targets CD25/IL-2RA in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: CTLL-2 cells, Recombinant protein Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Proliferation of T lymphocytes is triggered by the interaction of IL-2 with its specific receptor following T lymphocyte activation. The receptor for IL-2 has three forms, generated by different combinations of three different proteins, the alpha chain (IL-2R alpha), the beta chain (IL-2R beta), and the gamma chain (IL-2R gamma) (PMID: 8476561). IL-2R alpha (also known as CD25) is a type I transmembrane protein present on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. CD25 is also found on natural CD4+ Foxp3+ Treg cells (PMID: 22585674). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1453 Product name: Recombinant Rat CD25/IL-2R alpha protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-235 aa of NM_013163.1 Sequence: ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNELVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHCREPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCVDEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQ Predict reactive species Full Name: interleukin 2 receptor, alpha Calculated Molecular Weight: 31kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: NM_013163.1 Gene Symbol: Il2ra Gene ID (NCBI): 25704 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26897 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.