Iright
BRAND / VENDOR: Proteintech

Proteintech, 86224-2-RR, NEK1 Recombinant monoclonal antibody

CATALOG NUMBER: 86224-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The NEK1 (86224-2-RR) by Proteintech is a Recombinant antibody targeting NEK1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86224-2-RR targets NEK1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue, HEK-293T cells, K-562 cells, PC-12 cells, rat testis tissue Positive IF/ICC detected in: Starvation treated hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information NEK1 (NIMA-Related Kinase 1) is a serine/threonine-protein kinase that plays a multifaceted and critical role in cellular homeostasis. It is widely expressed and involved in key biological processes, most notably the DNA Damage Response (DDR) and cilium assembly and function. NEK1 kinase activity is regulated in response to genotoxic stress, where it facilitates the repair of double-strand breaks alongside proteins like ATM and ATR. Simultaneously, it localizes to the basal body of the primary cilium, governing ciliary structure and trafficking. The paramount importance of NEK1 is highlighted by its strong genetic association with Amyotrophic Lateral Sclerosis (ALS); loss-of-function mutations in NEK1 are recognized as one of the most common genetic causes of familial and sporadic ALS. Furthermore, biallelic mutations in NEK1 are responsible for the severe ciliopathy known as short-rib thoracic dysplasia, underscoring its vital role in skeletal development. Thus, NEK1 represents a crucial molecule at the crossroads of genome integrity, ciliary function, and human neurodegenerative and developmental diseases. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25970 Product name: Recombinant human NEK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 557-740 aa of BC114491 Sequence: KRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTD Predict reactive species Full Name: NIMA (never in mitosis gene a)-related kinase 1 Calculated Molecular Weight: 1258 aa, 143 kDa Observed Molecular Weight: 170-180 kDa GenBank Accession Number: BC114491 Gene Symbol: NEK1 Gene ID (NCBI): 4750 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96PY6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924