Iright
BRAND / VENDOR: Proteintech

Proteintech, 86229-1-RR, JAM-A/CD321 Recombinant monoclonal antibody

CATALOG NUMBER: 86229-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The JAM-A/CD321 (86229-1-RR) by Proteintech is a Recombinant antibody targeting JAM-A/CD321 in WB, IF/ICC, ELISA applications with reactivity to mouse, rat samples 86229-1-RR targets JAM-A/CD321 in WB, IF/ICC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: bEnd.3 cells, rat lung tissue, mouse lung tissue, mouse testis tissue, mouse liver tissue Positive IF/ICC detected in: bEnd.3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Junctional Adhesion Molecule-A (JAM-A), also known as CD321 or F11R, is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. It is primarily located in the tight junctions of epithelial and endothelial cells and is also expressed on circulating platelets and leukocytes (PMID: 34533648). Targeting F11R/JAM-A with monoclonal antibodies or peptide antagonists has shown promise in inhibiting tumor growth and metastasis in mouse models (PMID: 37563645). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3117 Product name: Recombinant Mouse JAM-A/Junctional Adhesion Molecule A protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-238 aa of NM_172647.2 Sequence: KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGG Predict reactive species Full Name: F11 receptor Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: NM_172647.2 Gene Symbol: F11r Gene ID (NCBI): 16456 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O88792 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924