Iright
BRAND / VENDOR: Proteintech

Proteintech, 86249-1-RR, FKBP1A Recombinant monoclonal antibody

CATALOG NUMBER: 86249-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The FKBP1A (86249-1-RR) by Proteintech is a Recombinant antibody targeting FKBP1A in WB, ELISA applications with reactivity to human, mouse, rat samples 86249-1-RR targets FKBP1A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue, U-87 MG cells, PANC-1 cells, Neuro-2a cells, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information FKBP1A(FK506-binding protein 1A) is also named as FKBP1, FKBP12 and belongs to the FKBP-type PPIase family.It keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0406 Product name: Recombinant human FKBP1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-108 aa of BC001925 Sequence: ETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE Predict reactive species Full Name: FK506 binding protein 1A, 12kDa Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC001925 Gene Symbol: FKBP1A Gene ID (NCBI): 2280 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P62942 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924