Iright
BRAND / VENDOR: Proteintech

Proteintech, 86252-1-RR, CD86 Recombinant monoclonal antibody

CATALOG NUMBER: 86252-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CD86 (86252-1-RR) by Proteintech is a Recombinant antibody targeting CD86 in WB, ELISA applications with reactivity to rat samples 86252-1-RR targets CD86 in WB, ELISA applications and shows reactivity with rat samples. Tested Applications Positive WB detected in: rat spleen tissue, rat thymus tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CD86 (also known as B7-2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and CTLA-4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with CTLA-4 negatively regulates T-cell activation and diminishes the immune response. (PMID: 7513726; 1847722; 11029388; 27591335) Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3586 Product name: Recombinant Rat CD86 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 30-248 aa of NM_020081.1 Sequence: PVKRQAYFNSTAYLPCPFTKAQNISPSELVVFWQDRKKSVLYEHYLGAEKLDNVNAKYLGRTSFDRDNQALRLHNVQIKDTGLYDCFIQQKTPTGSIILQQWETELSVIANFSEPEIEEAQNETRNTGINLTCSSKQGYPKPTKMYFLITNSTNEYGDNMQISQDNVTKLFSVSISLSLPFPDGVYNMTIVCILETESMNISSKPHNMVFSQPQFDRKT Predict reactive species Full Name: CD86 molecule Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: NM_020081.1 Gene Symbol: Cd86 Gene ID (NCBI): 56822 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O35531 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924