Iright
BRAND / VENDOR: Proteintech

Proteintech, 86261-1-RR, CXCL3/GRO Gamma Recombinant monoclonal antibody

CATALOG NUMBER: 86261-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CXCL3/GRO Gamma (86261-1-RR) by Proteintech is a Recombinant antibody targeting CXCL3/GRO Gamma in WB, ELISA applications with reactivity to human, mouse, rat samples 86261-1-RR targets CXCL3/GRO Gamma in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, A549 cells, rat lung tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CXC chemokine ligand 3 (CXCL3) is a member of CXC-type chemokine family that is identified as a major regulator in immune and inflammation responses. CXCL3 is broadly expressed in various human tumor types, and it is also known to play a critical role in mediating tumor development and progression. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2982 Product name: recombinant human CXCL3 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 35-107 aa of NM_002090.3 Sequence: ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN Predict reactive species Full Name: chemokine (C-X-C motif) ligand 3 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: NM_002090.3 Gene Symbol: CXCL3 Gene ID (NCBI): 2921 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P19876 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924