Iright
BRAND / VENDOR: Proteintech

Proteintech, 86265-3-RR, CSRP1 Recombinant monoclonal antibody

CATALOG NUMBER: 86265-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CSRP1 (86265-3-RR) by Proteintech is a Recombinant antibody targeting CSRP1 in WB, ELISA applications with reactivity to human, mouse samples 86265-3-RR targets CSRP1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells, Neuro-2a cells, C2C12 cells, mouse uterus tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CSRP1 (Cysteine and glycine-rich protein 1), designated initially as CRP1, constitutes a cysteine-rich protein derived from placental sources and exhibits a response profile analogous to c-myc. CSRP1 has been recognized as a tumor suppressor in several types of cancers including colorectal cancer, and cholangiocarcinoma (PMID: 37113556). Abnormal expression of CSRP1 was reported within several malignancies such as prostate cancer and acute myeloid leukemia (PMID: 38813484, 40198006). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4236 Product name: Recombinant human CSRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC032493 Sequence: MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE Predict reactive species Full Name: cysteine and glycine-rich protein 1 Calculated Molecular Weight: 193 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC032493 Gene Symbol: CSRP1 Gene ID (NCBI): 1465 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P21291 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924