Iright
BRAND / VENDOR: Proteintech

Proteintech, 86284-1-RR, GNGT2 Recombinant monoclonal antibody

CATALOG NUMBER: 86284-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GNGT2 (86284-1-RR) by Proteintech is a Recombinant antibody targeting GNGT2 in WB, ELISA applications with reactivity to human, mouse, rat samples 86284-1-RR targets GNGT2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse retina tissue, rat retina tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information GNGT2, also known as GNG8, GNG9 and GNGT8, belongs to the G protein gamma family. Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. This antibody has weak cross-reactivity of GNGT1 protein, as the immunogen of GNGT2 shares about 65% homology with GNGT1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4093 Product name: Recombinant human GNGT2 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-69 aa of BC008663 Sequence: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS Predict reactive species Full Name: guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 Calculated Molecular Weight: 69 aa, 8 kDa Observed Molecular Weight: 8 kDa GenBank Accession Number: BC008663 Gene Symbol: GNGT2 Gene ID (NCBI): 2793 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14610 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924