Iright
BRAND / VENDOR: Proteintech

Proteintech, 86336-1-RR, ZnT4 Recombinant monoclonal antibody

CATALOG NUMBER: 86336-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ZnT4 (86336-1-RR) by Proteintech is a Recombinant antibody targeting ZnT4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 86336-1-RR targets ZnT4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, mouse brain tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information ZnT4, also known as SLC30A4, belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. ZnT4 transports Zn into the trans-Golgi apparatus for lactose synthesis, and across the apical cell membrane for efflux from MECs into milk. ZnT4 is expressed in numerous tissues and is enriched in the prostate. ZnT4 encodes a protein with a molecular weight of 47 kDa (PMID: 26538236). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3313 Product name: Recombinant human SLC30A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC026089 Sequence: MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPERPVNGAHPTLQADDDSLLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVL Predict reactive species Full Name: solute carrier family 30 (zinc transporter), member 4 Calculated Molecular Weight: 429 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC026089 Gene Symbol: ZNT4 Gene ID (NCBI): 7782 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14863 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924