Iright
BRAND / VENDOR: Proteintech

Proteintech, 86354-1-RR, DUSP19 Recombinant monoclonal antibody

CATALOG NUMBER: 86354-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The DUSP19 (86354-1-RR) by Proteintech is a Recombinant antibody targeting DUSP19 in WB, ELISA applications with reactivity to human, mouse samples 86354-1-RR targets DUSP19 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: U2OS cells, mouse pancreas tissue, HepG2 cells, HuH-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information DUSP19 (Dual-Specificity Phosphatase 19), also known as SKRP1, LMW-DSP3, or SAPK pathway-regulating phosphatase 1, is a low-molecular-weight member of the dual-specificity phosphatase family. It is encoded on human chromosome 2q32 and expressed in multiple tissues, with the highest levels found in the pancreas and heart. Structurally, DUSP19 contains a conserved catalytic domain that removes phosphate groups from both phospho-tyrosine and phospho-serine/threonine residues, enabling it to negatively or positively regulate MAPK signaling. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3611 Product name: Recombinant human DUSP19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC035000 Sequence: MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS Predict reactive species Full Name: dual specificity phosphatase 19 Calculated Molecular Weight: 217 aa, 24 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC035000 Gene Symbol: DUSP19 Gene ID (NCBI): 142679 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8WTR2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924