Iright
BRAND / VENDOR: Proteintech

Proteintech, 86358-1-RR, MSRA Recombinant monoclonal antibody

CATALOG NUMBER: 86358-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MSRA (86358-1-RR) by Proteintech is a Recombinant antibody targeting MSRA in WB, IF/ICC, ELISA applications with reactivity to human, rat samples 86358-1-RR targets MSRA in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: THP-1 cells, HT-1080 cells, rat kidney tissue Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Methionine sulfoxide reductase A (MSRA) is an antioxidant enzyme found in all domains of life that catalyzes the reduction of methionine-S-sulfoxide (MSO) to methionine in proteins and free amino acids (PMID: 28874471). MSRA has some isoforms with MW of 19~26 kDa. MSRA functions in the repair of oxidatively damaged proteins to restore biological activity. Transfection of MSRA reduced colony formation and the invasiveness of HCC cell lines. Studies have demonstrated the downregulation of MSRA in multiple human tumors, including breast cancers and its levels have been linked to advanced tumor grades (PMID: 20937881). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6053 Product name: Recombinant human MSRA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of BC054033 Sequence: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK Predict reactive species Full Name: methionine sulfoxide reductase A Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 24-26 kDa GenBank Accession Number: BC054033 Gene Symbol: MSRA Gene ID (NCBI): 4482 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UJ68 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924