Iright
BRAND / VENDOR: Proteintech

Proteintech, 86378-1-RR, GLDC Recombinant monoclonal antibody

CATALOG NUMBER: 86378-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GLDC (86378-1-RR) by Proteintech is a Recombinant antibody targeting GLDC in WB, ELISA applications with reactivity to human, mouse, rat, monkey samples 86378-1-RR targets GLDC in WB, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: HepG2 cells, Vero cells, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information GLDC(Glycine dehydrogenase [decarboxylating], mitochondrial) is also named as GCSP and belongs to the GcvP family. It induces dramatic changes in glycolysis and glycine/serine metabolism that leads to changes in pyrimidine metabolism to regulate cancer cell proliferation(PMID:22225612). Specification Tested Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20410 Product name: Recombinant human GLDC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 675-1020 aa of BC111995 Sequence: NIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVISLKRNEDACPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS Predict reactive species Full Name: glycine dehydrogenase (decarboxylating) Calculated Molecular Weight: 1020 aa, 113 kDa Observed Molecular Weight: 113 kDa GenBank Accession Number: BC111995 Gene Symbol: GLDC Gene ID (NCBI): 2731 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P23378 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924