Iright
BRAND / VENDOR: Proteintech

Proteintech, 86396-1-RR, IL-25/IL-17E Recombinant monoclonal antibody

CATALOG NUMBER: 86396-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IL-25/IL-17E (86396-1-RR) by Proteintech is a Recombinant antibody targeting IL-25/IL-17E in WB, ELISA applications with reactivity to human, mouse, rat samples 86396-1-RR targets IL-25/IL-17E in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, rat testis tissue, LoVo cells, SW480 cells, mouse colon tissue, mouse testis tissue, rat colon tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3316 Product name: recombinant mouse IL25/IL-17E protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 17-169 aa of NM_080729.3 Sequence: VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA Predict reactive species Full Name: interleukin 25 Calculated Molecular Weight: 19KD Observed Molecular Weight: 20 kda GenBank Accession Number: NM_080729.3 Gene Symbol: Il25 Gene ID (NCBI): 140806 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8VHH8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924