Iright
BRAND / VENDOR: Proteintech

Proteintech, 86422-1-RR, SLAMF6 Recombinant monoclonal antibody

CATALOG NUMBER: 86422-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SLAMF6 (86422-1-RR) by Proteintech is a Recombinant antibody targeting SLAMF6 in WB, IF/ICC, ELISA applications with reactivity to mouse samples 86422-1-RR targets SLAMF6 in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue, mouse thymus tissue Positive IF/ICC detected in: A20 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Signaling lymphocyte activation molecule 6 (SLAMF6) (Ly108 in mice, NTB-A or SF2000 in humans) is a homophilic receptor belonging to the superfamily immunoglobulin (Ig) domain-containing molecules (PMID:31199820). SLAMF6 is a type I transmembrane protein with two extracellular immunoglobins (Ig)-like domains and three cytoplasmic tyrosine-based signaling motifs, one of which is immunoreceptor tyrosine-based switch motif (PMID:31315913). SLAMF6 is expressed on a wide variety of immune cells including T cells (also TFH), B cells, NK cells (expressed in humans only), double positive thymocytes, eosinophils, and neutrophils (mouse only) (PMID:11862385). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5249 Product name: recombinant mouse SLAMF6/CD352 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 31-239 aa of NM_030710.2 Sequence: EVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTNPPWN Predict reactive species Full Name: SLAM family member 6 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_030710.2 Gene Symbol: Slamf6 Gene ID (NCBI): 30925 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9ET39-2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924