Iright
BRAND / VENDOR: Proteintech

Proteintech, 86432-1-RR, CEBPE Recombinant monoclonal antibody

CATALOG NUMBER: 86432-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CEBPE (86432-1-RR) by Proteintech is a Recombinant antibody targeting CEBPE in WB, IF/ICC, ELISA applications with reactivity to human samples 86432-1-RR targets CEBPE in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HL-60 cells Positive IF/ICC detected in: HepG2 cells, A431 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information CEBPE (CCAAT/enhancer binding protein epsilon), also known as C/EBP-epsilon and CRP1, is a transcription factor involved in late myeloid lineage differentiation and cellular function (PMID: 31201888). CEBPE is expressed in a stage-specific manner during myeloid differentiation and regulates transition from the promyelocyte to the myelocyte (PMID: 29773596). Depletion of CEBPE in Acute lymphoblastic leukaemia (ALL) cells reduces cell growth, correspondingly CEBPE binds to the promoters of electron transport and energy generation genes (PMID: 29977016). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5589 Product name: Recombinant human CEBPE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-281 aa of BC035797 Sequence: MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS Predict reactive species Full Name: CCAAT/enhancer binding protein (C/EBP), epsilon Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31-38 kDa GenBank Accession Number: BC035797 Gene Symbol: CEBPE Gene ID (NCBI): 1053 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15744 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924