Iright
BRAND / VENDOR: Proteintech

Proteintech, 86440-1-RR, TMCO1 Recombinant monoclonal antibody

CATALOG NUMBER: 86440-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TMCO1 (86440-1-RR) by Proteintech is a Recombinant antibody targeting TMCO1 in WB, IHC, ELISA applications with reactivity to human samples 86440-1-RR targets TMCO1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, L02 cells, Calu-3 cells, MDA-MB-231 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information TMCO1, also known as TMCC4, PNAS-10, and PNAS-136, is a 188 amino acid protein, which is widely expressed in adult and fetal tissues, with higher levels in thymus, prostate, testis and small intestine and lower levels in brain, placenta, lung and kidney (PubMed:10393320, PubMed:20018682). TMCO1 as a Calcium-selective channel is required to prevent calcium stores from overfilling, thereby playing a key role in calcium homeostasis (PubMed:27212239). In response to endoplasmic reticulum overloading, TMCO1, assembles into a homotetramer, forming a functional calcium-selective channel, regulating the calcium content in endoplasmic reticulum store (PubMed:27212239). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26278 Product name: Recombinant human TMCO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 111-188 aa of NM_019026 Sequence: MGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS Predict reactive species Full Name: transmembrane and coiled-coil domains 1 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: NM_019026 Gene Symbol: TMCO1 Gene ID (NCBI): 54499 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UM00 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924